PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676783188
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family HB-other
Protein Properties Length: 1125aa    MW: 127562 Da    PI: 7.6373
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676783188genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.12.7e-0746812156
               HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               +++yp+ +e+ +L k+lgLt + V+ WF+ rR  +k
  676783188 46 EQMYPTPKEMDDLGKSLGLTVKEVRGWFKRRRCTRK 81
               589*****************************8777 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-7582IPR009057Homeodomain-like
CDDcd000867.03E-64581No hitNo description
PfamPF000468.1E-54681IPR001356Homeobox domain
SuperFamilySSF466891.11E-54684IPR009057Homeodomain-like
PROSITE profilePS500719.8964983IPR001356Homeobox domain
PfamPF156121.1E-8599642IPR028942WHIM1 domain
PfamPF156136.2E-11743816IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1125 aa     Download sequence    Send to blast
MKMKSAVQLQ ALEGFYLALQ DIYLGLCLSG GGFYVSDGFF VYVNLEQMYP TPKEMDDLGK  60
SLGLTVKEVR GWFKRRRCTR KEVKSLAKNP QPYNRSHTRS SSSSRCDFGE AVGIRKITCQ  120
KLLTSQHILA KIFRKDGPSL GCEFDHLPAG ARKASWLGSS SLHQQKERVA RKRKISELME  180
HTSQDCVEKN ATVKKHGIGK GFMTVWRVMN PNSRDASLHE RATLAQSSAR NPPHQKKNQR  240
QLASILKQKL LQKRSREKKR CSINREVELN KDEAQLAFKE KCELGVDGKK ETCQTISILV  300
DDEELEMRER QEGASPLTCS CHTTSSGSHG CFLCKDLLPK FPPNSVQMRL PFGLHPWNYS  360
PESVKKLFKL LLLDVETELQ RGSFSNLSIS CKFLALLQSV ESQILILDMW KDSLNSLTWT  420
EILRQILVAA GFGSEKCAGQ SEELSKESRL MKKYGLRLGT LKGELFRMLN EQGNNGLKIS  480
ELANAAEVVA QNLASTSEER ERSLCSTLAS DITIFEKISE CTYRVRVSCL SEDPDKSQSD  540
SDESGSVDDE AGDCLFSSGD ENERVSEDFA LRKVKCRKRR KHKSKMLEVC SEIDESHPGQ  600
PWLLGLMEGE YSDLSIEEKL DVFVALIDLL SSGSTIRMEE MNFSYFSITA MSLVRRANLY  660
LVPQDLPRSM VDCVPSIYSR SGGKIKRSSS NQYSYPRVSW VHGGDRIEEL SKSSDSHPID  720
SSSILGGFAK FAGDKANNVH PMQSVYLGSD RRFNRYWLFL GPCSANDPGH RCVYFESSED  780
GHWEVISNKE ALRALLSVLD DRGRREARLI ESLEKRESFL CQAMLSRIDH FTDVVREDSS  840
SPVSDIDNNL CLNEIANDQF SSQHAAIIFE IGSKREKSLL WSLVQEFDEW IWANFNLNLN  900
AVKHSRRSYL DSLTRCKSCH DLYWRDEKHC KICHATFELE VDLEERYAIH AATCRKNEES  960
DTFPDHKVLS SQLQSLKAAM YAIESTMPED ALIGAWKKSA HRLWAKRLRR SSTLSEITQV  1020
IGDFVRAINE DWLWHFGDEE HSNTSLGEVI TSFSSMPQTT SAMALWLVKL DTLVAPYVEK  1080
PQPGRNQLCR TRNTTISGFH IFDNLVGERQ SRSCSSHLDI MEGHR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0496401e-171AL049640.1 Arabidopsis thaliana DNA chromosome 4, BAC clone T20K18 (ESSA project).
GenBankAL1615341e-171AL161534.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 34.
GenBankCP0026871e-171CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006415009.10.0hypothetical protein EUTSA_v10024262mg
SwissprotF4JRF50.0RLT3_ARATH; Homeobox-DDT domain protein RLT3
TrEMBLV4MLN10.0V4MLN1_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.9__93__AT4G12750.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96382125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12750.10.0Homeodomain-like transcriptional regulator